GenomeNet

>tdn:Suden_0128 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) Type II site-specific deoxyribonuclease (A)
MTYYENIREMTKIVPVQLVNFEEPRDKARTPTQASSNFITNKEQGDWAENLIARAINETS
NNFVAVKYGKSDNLVAGEDGFDAFYQDFQNELDTIGKRPDLLIFNKVDFDNSLGFDISQE
PHEEITDYVKKAIAGIEVRSSAFLIDRYEEAMQARTEKFVQIALETKDKILTDFSDVLEH
PARQSYIELLNSITASTLNVADFRVPSWSSSDRLIQVKNLFKQLKNAIKEIQKRDYLSIT
PKVEDLKVVYKWIETFNVPHFYFQVFFDKVYGISFEQILKIISDSDNDGVIFSVETDTKN
QNKTTIKINSKFGVPIALKVDEPLHESVRKEMDRGRLLFYVTFKGGTAYLDIENLRAILN
LEESIF

BLAST