GenomeNet

>tel:tll1504 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (RefSeq) rbcS; ribulose bisphosphate carboxylase small subunit (A)
MKTLPKERRYETFSYLPPLSDAQIARQIQYAIDQGYHPCVEFNETSNAEIRYWTMWKLPL
FNCTNAQDVLNEVQQCRSEYPNCFIRVVAFDNIKQCQVMSFIVYKPNQANSGYSGYRY

BLAST