GenomeNet

>tep:TepRe1_0436 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) Xylose isomerase domain-containing protein TIM barrel (A)
MFANISAGAWVYGTCSDRYVSDGYKDKMDFVSRVERLSNIEEVKGIEITYPFDINEENYD
HYKTLLEEKSLTISCIGVELVCDRKWKTGSFCSPHKEVREETIKLVKKAMDFANQIGVEI
VNLWLGQDGFDYLMQTNYVDAWKFLIEGLRECANHNTKVKLGLEYKASEPRLNCFLNSGG
KALAVAQATGCSNVGVTLDIGHALNAKENPAEIASILMAENKLFHLHFNDNYFIADDDMP
VGSVHFLHFVELIYWLKKLGYSGWYSLDLYPYRDDPDEACKTSIHFIRMIEKMVEKKLKD
LDFHEMAETAASKNMCNLFTKMFDMGE

BLAST