GenomeNet

>tep:TepRe1_0436 xylose isomerase domain-containing protein; K01805 xylose isomerase [EC:5.3.1.5] (A)
MFANISAGAWVYGTCSDRYVSDGYKDKMDFVSRVERLSNIEEVKGIEITYPFDINEENYD
HYKTLLEEKSLTISCIGVELVCDRKWKTGSFCSPHKEVREETIKLVKKAMDFANQIGVEI
VNLWLGQDGFDYLMQTNYVDAWKFLIEGLRECANHNTKVKLGLEYKASEPRLNCFLNSGG
KALAVAQATGCSNVGVTLDIGHALNAKENPAEIASILMAENKLFHLHFNDNYFIADDDMP
VGSVHFLHFVELIYWLKKLGYSGWYSLDLYPYRDDPDEACKTSIHFIRMIEKMVEKKLKD
LDFHEMAETAASKNMCNLFTKMFDMGE

BLAST