GenomeNet

>tep:TepRe1_0656 phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II; K15778 phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2] (A)
MKINPYIFRQYDIRGVVGEDLDENFARRLGQAFGTYTLKNNETSVIVGCDNRISSPSLKK
AVTEGLLSTGCNVVDIGTVVTPIFYYARIHFNINPGIMVTASHNPAQFNGFKVAFGPGTI
YGDEIQNLRIMMEKGDFLSGQGSLTYKDPSEDYIDMICEKIHLSKKLRVGIDCGNGTASL
FAEKLFRRLGVDVYPLYCESDPKFPNHFPDPVKPENLTDLKELVLREKLDLGIGFDGDGD
RIGVVDDKGNIIYGDMLMILYWREIMPKYPGAVAIIEVKCSQALVDEVKKLGGKPIFYKT
GHSLIKAKMREIGAVFTGEMSGHMFFADEYYGFDDALYAAARLLRILSNTDKKLSELLAD
VPKYYSTPELRVPCPDEEKFDKVEAVKRYFQDKYPIIDVDGARVIFPDGWGLVRSSNTGP
ELIVRCEATSKDGLDKIKNEIQKALLPLKLF

BLAST