GenomeNet

>tep:TepRe1_1983 aspartate kinase; K00928 aspartate kinase [EC:2.7.2.4] (A)
MAIIVQKFGGTSVKSPENRKAVLNHILKAKEKGYDVVVVVSAMGRLGDPYATDTLINLLK
AQGGEICPKKKDLIMSCGEIISAAVMASYIEAQGVKAEAMTGFQAGILTTADFGNAEILR
VDPLPITEKLKEGNVVVVAGFQGQTEKGEITTLGRGGSDTTAVVLGGYLKADLVEIYTDV
PGIAVTDPRVLPEAPFILQISYDEVIAMAENGAKVIHPRAVRAAKEFGMALRIKSTFDEG
DGTLVGPEESDLVISGITSQSGFTAAKFESEDEFSSDDIKEFLKLSCDSSIYLSSVGENI
ILIEEEKKDMAANLAKELKSSAEFCHDMAKVSVICKSTINIKALTESIANLLLKNGVQIV
AAANSNNCSKYIIKGKNASKAVSIIFNEYFSSKN

BLAST