GenomeNet

>ter:Tery_4410 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSYAKTQTQSKSGYQAGVKDYKLTYYTPDYIPKDTDLLAAFRMSPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIESVPGEDNQYICYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRSLRLEDLRIPVAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFAQEAIEKAQAETGEIKGHY
LNVTAPTCEEMLERADFAKEIGTPIIMHDYLTGGFTANTTLAKWCRRNGVLLHIHRAMHA
VIDRQKAHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHVEQDRE
RGIYFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLFREGGDVIREAAKWSPDLAVACELWKEIKFEFEAMDTL

BLAST