GenomeNet

>tet:TTHERM_00047080 succinate dehydrogenase, flavoprotein subunit containing protein (EC:1.3.5.1); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MFKYLSKIQRVTLHSKVSKNFAVLSKDHPEKGPSQGHLTDKYTVIDHTYDAIVVGAGGAG
LRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHFYDTVKGSDWL
GDQDAIQYMTREAPAAVLELESYGLPFSRTPEGKIYQRAFGGQSLKFGKGGQARRTACAA
DRTGHAMLHTLFGRSLAYNCNFFIEYFVIDLIMDEEGACRGVICMSMADGSIHRIRAHYT
VLAAGGYGRSYLSCTAAHTCTGDGMALATRAGLPLEDPEFVQFHPTGIYGSGCLMTEGCR
GEGGILVNSNGEAFMEKYAPTAKDLASRDVVSRAMTIEILEGRGVGPKKDHIFLQLHHLS
PETLHQRLPGISETARIFAGVDVTKEPAPVVPTVHYNMGGVPTNWKTEVITQDKNGKDKI
VPGLLAAGENACASVHGANRLGANSLLDIVVFGRAAAKLVKEKLKPGTPHKDLPKNAGEQ
ALARLDKYRFANGEYTTHHVRTAMQETMQRHAAVFRIEKLMAEGVQKLDHIYEQSKSLKT
FDRGLVWNTDLIETLELENLLLCSKQTLLAGLLRKESRGAHARDDFKERDDKNWMKHSLT
WIKDVNTGKTEVTYRDVINHTLDSEVTPVPPAKRSY

BLAST