GenomeNet

>tet:TTHERM_00059350 Copper/zinc superoxide dismutase family protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MLVKSVLLGAAGTALFSYSNQKTYKAEKNAGERIAIAILYPAPGYDVTGAVTFYQKDLHS
KTQITARLKNLNPNGLFGFHIHEFGDLTNGTESVGPHYNPFNKKHGSPREDESHMGDLGN
IKADDLGYGYYTSENNKVTLFGEYSVVGRSVLVNKNEDDLGRGNHPDSHTNGHSGPRIAA
GIIGLAYELKNLPARF

BLAST