GenomeNet

>tet:TTHERM_00059350 superoxide dismutase [Cu-Zn] protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MLTLLSKFIQTKSDIYLEQIFNFLVTKFYIKISQKILLKIARQIQTNKQTNLSKKHILKS
RMLVKSVLLGAAGTALFSYSNQKTYKAEKNAGERIAIAILYPAPGYDVTGAVTFYQKDLH
SKTQITARLKNLNPNGLFGFHIHEFGDLTNGTESVGPHYNPFNKKHGSPREDESHMGDLG
NIKADDLGYGYYTSENNKVTLFGEYSVVGRSVLVNKNEDDLGRGNHPDSHTNGHSGPRIA
AGIIGLAYELKNLPARF

BLAST