GenomeNet

>tet:TTHERM_00059350 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) superoxide dismutase [Cu-Zn] protein (A)
MLTLLSKFIQTKSDIYLEQIFNFLVTKFYIKISQKILLKIARQIQTNKQTNLSKKHILKS
RMLVKSVLLGAAGTALFSYSNQKTYKAEKNAGERIAIAILYPAPGYDVTGAVTFYQKDLH
SKTQITARLKNLNPNGLFGFHIHEFGDLTNGTESVGPHYNPFNKKHGSPREDESHMGDLG
NIKADDLGYGYYTSENNKVTLFGEYSVVGRSVLVNKNEDDLGRGNHPDSHTNGHSGPRIA
AGIIGLAYELKNLPARF

BLAST