GenomeNet

>tet:TTHERM_00151810 elongation factor Tu protein (A)
MFKNILKLGSNTQKTLSAIPCYGFAKFQRNKPHLNVGTIGHIDHGKTTLTAAITKICADK
KLAEFMAYDSIDKAPEEKARGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKM
DAGILVCSATDGVMPQTREHILLCRQVGVKTIIVFVNKCDMAKDPEIQELVEMEVRELLS
KYEYNGDEAPVIFGSALCALNGTDPEIGINKINTLLDTMDKQIALPERTVDKPFMMSVEG
TYQIPGRGTVVTGTVDTGKVKTGEDIEIVGYSNKVLKTTITGIETFRKQLDYAEAGDNVG
LLLRGVTRDDVRRGQVLSKPGTQESHKKIEANLYILTEQEGGRKKPFPDGYRPQLYLRTA
DVAAQISIHGANKLGMPGDNITANLDLHFPLPVAPGKLTIILFNNQCQQQNNFQIKGLRF
ALREGGKTIAAGVISKVIPEEKEAPKK

BLAST