GenomeNet

>tet:TTHERM_00289080 Pyridoxal-dependent decarboxylase conserved domain containing protein (A)
MEQQDQHLLANDKKLNEKFLDDVFQILKKIILECKTGNGKVIDFKTPDQLIKEIDLTLPL
KGQSDEEIINFIKLVDKYSVKTSHSHFFNNLFGGSNEYSLAGDYFTSTINGSMYTYEMAP
VFNFMENAIQQLFAERYLKWSTIDGVFCPGGSQSNFYGILAARQHKYPEFKRKGLRALPD
LKLFTSELAHYSIEKGAIMLGFGLDSVVKIACDEEGRMIPEEFEKEIQKCIQEGSVPLMV
NLTCGTTVFGVVDPINKCTEIAQKYNMWVHIDGCWGGHLIFLEEFRNKYSLISQADSFAW
DAHKLFNVPQQCTAFFTRHVGLLHEANALGSDYLFMKDKKLYDATKYDSGDKTYQCARHI
DVFKFWIYWKHFGTLGLEQIVADSLETTKYFAQLVKDHPNCELINEPEYVSVSFFYYPDS
FLKRKELGEDKTEKFWEDMHNIPPIIKAKMVEQGTMMVAYQKQNQKSIQRKNFFRFIFTA
DKGKEEAQFALNEIHRLGKDL

BLAST