GenomeNet

>tet:TTHERM_00392850 ATP dependent DNA ligase domain containing protein (EC:6.5.1.1); K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] (A)
MIKIDLTKPVFLNFNQSKFWEISLLDGNKSQIRYGKLVQGEEIEEKTQIVQKQHKDTDSC
LDYIIRVIENKKLKGYSGDIPMKKNEPQIIIPANNASGFSIQISAPKSVENNANDDKDSK
VDSNTQAYLQENKTWSSQFVILTLSGNEVEEIIGKLGIKKTWEKSSTILSANQCKLYFKN
QIEEYERKGYVRDDSQYNFQLNEVNKHFSAQNGSSNNNQLDLNQKGKKKNFNKDSGLYDD
SHSNISGISDQSDLTARSGGSQLDLSFDKGDDDDGNSSVVVTGEIKKGSLGANGSMDSGV
LLAQAMPDEMDPTGWYASEKMDGVRAVWTGKTFYSRNGNEFYPPPFFIQNFPNCTLDGEL
FTKRDDFQRCVGIVKTKNGNEEKDERWKDIVYLVYDCPKLLKPFKDRIKALQEQIPKLGN
KYIKVLPHKIVESREQLESELDRVLKNNGEGLMLRDPNSMYECRRSKTLLKVKTFTDEEA
TVIGSERGEGRCADMMGALVCRMKNGKEFKIGSGFNDDQRRRPPKKGSVITFKYQNLTKD
GKPRFPIFLRIKEDE

BLAST