GenomeNet

>tet:TTHERM_00392850 ATP dependent DNA ligase domain containing protein (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MIKIDLTKPVFLNFNQSKFWEISLLDGNKSQIRYGKLVQGEEIEEKTQIVQKQHKDTDSC
LDYIIRVIENKKLKGYSGDIPMKKNEPQIIIPANNASGFSIQISAPKSVENNANDDKDSK
VDSNTQAYLQENKTWSSQFVILTLSGNEVEEIIGKLGIKKTWEKSSTILSANQCKLYFKN
QIEEYERKGYVRDDSQYNFQLNEVNKHFSAQNGSSNNNQLDLNQKGKKKNFNKDSGLYDD
SHSNISGISDQSDLTARSGGSQLDLSFDKGDDDDGNSSVVVTGEIKKGSLGANGSMDSGV
LLAQAMPDEMDPTGWYASEKMDGVRAVWTGKTFYSRNGNEFYPPPFFIQNFPNCTLDGEL
FTKRDDFQRCVGIVKTKNGNEEKDERWKDIVYLVYDCPKLLKPFKDRIKALQEQIPKLGN
KYIKVLPHKIVESREQLESELDRVLKNNGEGLMLRDPNSMYECRRSKTLLKVKTFTDEEA
TVIGSERGEGRCADMMGALVCRMKNGKEFKIGSGFNDDQRRRPPKKGSVITFKYQNLTKD
GKPRFPIFLRIKEDE

BLAST