GenomeNet

>tet:TTHERM_00411610 Alpha amylase, catalytic domain containing protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MSKLQFVLIAALLLVAVSAKTAQEWKTRNIYQIITDRFALGDGSKPYCDLNKQPYYCGGN
FKGIENNLDYIQGMGFNAIWISPVPDNYPNQFHGYAAKNMTEINSHFGGADGLKSLIDAC
HKRDIWVMIDVVANHMGNTDQNYSENIPFNSPDHYHSYCIISDSDFATKNMYNIQHCRLA
GLADLNQENSYVSNYLVNWIKDLVQTYNVDGIRIDTVPEVHPDFWKQYTTSAGVFATGEV
FDGDFGYVASYIPSVGSVLNYPWYFNMRDIFVNQKDMWGVRTYYQNWANQHADLSILTPF
VDNHDNPRFLSDQVFNNGKDRNTRIQLLKGYTTFTLTSIGIPILYYGTEQYFSGNTDPYD
REPLWNSLNTNSDMYKYVQSILYAKNITNAGLQGQTEAYCDQDLYAFFRGKLFVGVTSKF
NQVTRQIVTHPFSNGEVICNIFYPTQDCLTITNNSFNLVLIGGEAKIFVPKSLLQKSSQF
LRSASS

BLAST