GenomeNet

>tet:TTHERM_00411610 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) alpha amylase domain protein (A)
MSKLQFVLIAALLLVAVSAKTAQEWKTRNIYQIITDRFALGDGSKPYCDLNKQPYYCGGN
FKGIENNLDYIQGMGFNAIWISPVPDNYPNQFHGYAAKNMTEINSHFGGADGLKSLIDAC
HKRDIWVMIDVVANHMGNTDQNYSENIPFNSPDHYHSYCIISDSDFATKNMYNIQHCRLA
GLADLNQENSYVSNYLVNWIKDLVQTYNVDGIRIDTVPEVHPDFWKQYTTSAGVFATGEV
FDGDFGYVASYIPSVGSVLNYPWYFNMRDIFVNQKDMWGVRTYYQNWANQHADLSILTPF
VDNHDNPRFLSDQVFNNGKDRNTRIQLLKGYTTFTLTSIGIPILYYGTEQYFSGNTDPYD
REPLWNSLNTNSDMYKYVQSILYAKNITNAGLQGQTEAYCDQDLYAFFRGKLFVGVTSKF
NQVTRQIVTHPFSNGEVICNIFYPTQDCLTITNNSFNLVLIGGEAKIFVPKSLLQKSSQF
LRSASS

BLAST