GenomeNet

>tet:TTHERM_00661650 glutathione S-transferase, amine-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MCLYIYIYPPKRYNFQKQQQINHKQNKTSLRNLIQYKQMTTLGYWGIRGLAQPIRFLLAY
LGVQYTNKAYANPEEWFGKDKNELGFDFPNIPYLIDGDLKLTESSAIPIYLIRKHKRNEL
LGSSADGSYSEKEVRVAQIVGVIRDLFKELTGLCFNPDFKNIKEKLYTEKLELLIKRLGA
YLGDKEFIVGTLTYADFLFYEALSYIRHIYPQAICATLTAYINRFENLPGIKEYIASHAQ
ELKVFLPPQRATWSGPQ

BLAST