GenomeNet

>tet:TTHERM_00794110 dehydrogenase, isocitrate/isopropylmalate family protein (EC:1.1.1.42); K00031 isocitrate dehydrogenase [EC:1.1.1.42] (A)
MWGISCIDASFQNSKKISKNFDKNKNIKNNNKFFSQKHTHLKRRLEMAELQKIKVTNPVT
ELDGDEMTRVIWQLIKDKLILPYLDLNIKYFDLGMEYRDQTDDKVTLDAAQSIVETKVGI
KCATITPDEARVKEFNLKKMWKSPNGTIRNHIGGTVFREPILMKNVPRLVPAWTKPIVIG
RHAFGDQYRATDFKVEEAGTFEIVFTPKNGGEKKVMKVFDYPAGGVGMGMYNTDESITEF
AHSSFKYALDRKMPLYLSTKNTILKAYDGKFKDIFQAIYDKQYKEEFTKAGIWYEHRLID
DMVAYMMKSEGGFMWACKNYDGDVQSDCLAQGFGSLGLMTSVLVGPNDIIEAEAAHGTVT
RHFRQHQKGQETSTNSIASIFAWTQGLLHRAKLDNNKELDLFCKTLESSVIETVETGFMT
KDLAICIQGSNDVPRSKYLTTQEFIDKVAETLRKNLVAAKSNL

BLAST