GenomeNet

>tet:TTHERM_00865240 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (RefSeq) DNA ligase I, ATP-dependent protein (A)
MIKKLLYLPKQSLLSSLIFSKFCTQFNSKSIQSFYFLAKQFDDISKISSRNSGIEAIETL
MNDYIQGGDNELFIQMVRLLTCKVDSEEIQIANSSLVEILKVVYPQEDITKFLFEKGDIG
LYAKEMLEKKLEKEGNNRTEKNHLSILEVTSFFEKLKNLQGDRSRLEKQELIIDFLKKIQ
DPLEIQYFIRILSKSLRIGVSEKSIIKALTNINKKKKNSLDSLLKNVQDKIFGYNTALHT
DIQIGTPVPPMLAKPVSDFDELLKFLKKYESKKVSLELKYDGERCQVHYGKKKGIKLFSR
NLEIQNEKYPQLVQQLEKYFQKNNSVEDCILDGEIVVTDSKGNIKSFQEQQQNRKRKQDS
NKVVAFDEDNIEKIYLFDILFLNACEQNTKEQLYRKSLIKENFPIEGPVNHAESKIFDLS
IQKDFDELKKLVKQYIDQKEEGAMVKSLDSNTFYDNNGRTQWAKLKKQVLSGGLADTFDV
IPIAAYYGKGKRSGVYGSYLLACYDDKKKEYVALCKIGTGFSDQFLQDSTDRLKQKVCSQ
KPKEYSVHRTFKPDVWFQKDAEVWEVESDSLSSSPIYTIGKMNYSDNGISLRFPRFLRVR
DDKTTEQSTKTYQIIEFYNKQQAKPNNNSKDQKGDHGDKGEEEEEGDK

BLAST