GenomeNet

>tfo:BFO_2659 K01077 alkaline phosphatase [EC:3.1.3.1] | (GenBank) alkaline phosphatase family protein (A)
MEPEQVKPVKNLIVLIPDGTSLATISTARWYQWYMNPDMPKLAIDPYICGTVRTHSSNAP
IGDSAPTTSCYMTGHPSRTGYVATYPPHDPGNDIYPMDPKRAYQPMMTLLEAMKLVQHKA
TGLVFTCEFTHATPADCSAHSYSRKRYEWIAPQMVHNDIDVVIGGGTSLLDEAGEAYLKA
NGYNVYRNDMAGMRSDNSNKMWALFGDRDMAYDIDRDPAQQPSIEEMTKKALDKLSKNEN
GFFLMVEGSKVDWAAHGNDPVGMLTDYLAFDKACRVAFDFARRDGHTLVVMVSDHGNSGF
SLGRRDCKGYDKLTKDQLFGTVTQIKLSADGFAKKLNEQPSSAVQEIFRQYAGFELTDEE
LQSLYHCKGYKNSPIPENERSEKEALASLYSSSLNGFIAKLITSKTCFGFTTNGHTGEDV
LLAAYHPAGTLPMGMHTNIELNHYMTAAVGLTGKLDELTDANFAPHTEVLKGYTYSILPP
ATEKENPTLVVKNKKKQLTITPYTNIVKLGKKGKEEMRLQTVIVYVDKNETFYLPRTITD
YLK

BLAST