GenomeNet

>tga:TGAM_0508 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; Thymidine kinase (tdk) (EC:2.7.1.21) (A)
MHPGGFLEVITGPMFAGKTTELIKRIERQAFARRKVALFKPSIDTRYSKEEVVAHNGLRY
EAFVVPTDENGVRRIMETTIREGFEVIGIDEVQFFPIEIVDVLNRLADEGVYVIASGLNL
DFKGDPFPVTRELLVRADNIVYLTAVCTVCGRPATRSQRLIDGKPAPRNSPVILVGGRES
YEARCREHHIVPEE

BLAST