GenomeNet

>tga:TGAM_1751 rbcL; Ribulose 1,5-bisphosphate carboxylase large subunit (RuBisCO) (rbcL) (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MADPFSFLCPYLGRKFNKPLFPSFLPPARRLNSRRGENPLRWLRMVEKFDKIYDYYVDKD
YEPNKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYD
FIDMGDGSWIVKIAYPFHAFEEWNLPGLLASIAGNVFGMKRVKGLRLEDLYFPEIVLRNF
SGPAFGIEGVRKMLEIYDRPLYGVVPKPKVGYSPEEFEKLAYELLSNGADYIKDDENLTS
PWYNRFDERAEIVTRVIDKVENETGEKKTWFANITADIREMERRLEVLADLGLKHAMVDV
VITGWGALEYIRDLAADYGLAIHGHRAMHAAFTRNKYHGISMFVLAKLYRIIGIDQLHVG
TAGAGKLEGGKWDVIQNARILREETYKPDENDVFHLEQKFYGMKAAFPTSSGGLHPGNIE
PVIEALGKDIVLQLGGGTLGHPDGPGAGARAVRQAIDAIMQGIPLDEYAKTHKELARALE
KWGHVTPV

BLAST