GenomeNet

>tga:TGAM_1751 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rbcL; Ribulose 1,5-bisphosphate carboxylase large subunit (RuBisCO) (rbcL) (A)
MADPFSFLCPYLGRKFNKPLFPSFLPPARRLNSRRGENPLRWLRMVEKFDKIYDYYVDKD
YEPNKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYPWYEQERWADLSAKAYD
FIDMGDGSWIVKIAYPFHAFEEWNLPGLLASIAGNVFGMKRVKGLRLEDLYFPEIVLRNF
SGPAFGIEGVRKMLEIYDRPLYGVVPKPKVGYSPEEFEKLAYELLSNGADYIKDDENLTS
PWYNRFDERAEIVTRVIDKVENETGEKKTWFANITADIREMERRLEVLADLGLKHAMVDV
VITGWGALEYIRDLAADYGLAIHGHRAMHAAFTRNKYHGISMFVLAKLYRIIGIDQLHVG
TAGAGKLEGGKWDVIQNARILREETYKPDENDVFHLEQKFYGMKAAFPTSSGGLHPGNIE
PVIEALGKDIVLQLGGGTLGHPDGPGAGARAVRQAIDAIMQGIPLDEYAKTHKELARALE
KWGHVTPV

BLAST