GenomeNet

>tga:TGAM_1791 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpA-2; Anaerobic glycerol-3-phosphate dehydrogenase subunit A, putative (glpA) (A)
MKTKVAIIGAGISGASIARVLSRYENLEVHLIEKAPDVGWGVSKANTALIHGGYDDDPEK
YPTRAKLCIRGNKLWHQWVKELEIPHVWNGALIVATKDEDFDELERLLERGRKNGVPEMR
IVDRDELFHLEPNLTREAIGALWVPIVGQIGPIPAVIAITENAVANGVKTHLETEVTGIK
VENGEVKGVETKDGFIEADIIINAAGLYADKIARMAGIDYFEIHPRKGEYWIFDDDVPGP
KRVLFPTPTPISKGIVVTTEISGHLMIGPNAQDLPPEEKENLATTKEGLEQVWEGAKKLW
PQLPPRSKVIRTFAGLRPEPTGGDFIIKAEEEVWGFISVAGIRSPGLTSAPAIAYEVAEI
IKRDLGIELKEKEKWNPYRKEISHFFTMTPEQVNEAIKKNPAYGKIVCRCNNVSEGDILE
AIERMKFIGVKTPSVDSVKFRTKATTGTCQGSFCRPKIVQLLAREYGVEPWKVTLKGKGS
EIGIGDVKVLLRGDA

BLAST