GenomeNet

>tgo:TGME49_015590 succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial, putative (EC:1.3.5.1); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MHASASLTQALRPYARRPLSSALSRSSLSPALAAGVARGLNAAQPQATGPSFVQQKRFFT
NVKKPAYRVIDHEYDAIVVGAGGAGLRAAFGLASAGIKTACLSKLFPTRSHTVAAQGGIN
AALGNMTEDDWRWHAYDTVKGSDWLGDQDAIQHMCREAPKVVRELESYGLPFSRTEDGRI
YQRAFGGQSLRFGKGGQAYRCAAAADRTGHAMLHSLYGQSLAHDCKFFVEYFALDLMMSG
ENDERKCHGVVAMCMEDGSIHRFAAKHTVLATGGYGRAYQSCTSAHTCTGDGGGMVSRAG
LPLEDLEFVQFHPTGIFPAGCLITEGCRGEGGILRNGQGEAFMARYAPTAKDLASRDVVS
RSMTIEIREGRGCGPNRDHMHLDLTHLPPATLHERLPGITETAKIFAGVNAEKEPIPVLP
TVHYNMGGIPTNWRAQVLTTSRSKAGGPDKIVQGLYAAGEAACASVHGANRLGANSLLDL
VVFGREAARTIADECKKDASAPSLPPNAGEETLAMVDRLRHSNGPLTTAQIRQRMQKTMQ
DHAAVFRTGAVLREGVEMMKDVAKSFADVGVKDRSLSWNTDLIETLELQNLLTQAVQTIV
GAEARKESRGAHAREDFKERDDKNWMKHTLSWQTHREVEKAEFPLTYRQVISQPLDNEME
HIPPAKRVY

BLAST