GenomeNet

>tgu:100190642 SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MAAAGRAGRAELRSPKMAAAAVGVSLRSRVPARLLRAGPRAVLRQAQTAAAAPRLKKFAI
YRWDPDKAGDKPRMQTYEVDLNKCGPMVLDALIKIKNEMDFTLTFRRSCREGICGSCAMN
IAGGNTLACIKKIDSDLSKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIQPYLKKKDESQ
EGKQQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRD
EFTEERL

BLAST