GenomeNet

>tgu:100217841 ACE; angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MPAALGLLLWLSLAGALRPGLEPPRHEPTEQGAALFASDYNTTAEIVLFDSVSASWNYST
NLTAENAALQVTASLEEQNFTELWGKRAKELYGDKWSNFSDPQLRKIIGSIQTLGPSNLP
LELREKYNTILSDMDKIYSTAKVYLPNGTCWDLEPDLSDIMATSRSYKKLLYAWEGWHNA
AGNPLRPKYEEFVKLSNKAYLEDGFNDTGSYWRSWYDSDSFEKDLEHIYHQLEPLYLNLH
AFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMIPYPEKPSLDVTSTMVQQ
GWNATHMFRVSEEFFTSLGLLEMPTEFWEKSMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTSVTMEQLFTVHHEMGHIQYYLQYKDQPVSFRSGANPGFHEAIGDVLSLSVSTPSHLK
KIGLLSNATEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYDWWYL
RTKYQGICAPLSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGSLH
TCDIYRSKEAGAKLREVLKAGSSKSWQDILLNLTGTGQMDAEPLLEYFSPVTKWLQEQNN
KTNEVLGWPEFDWRPPVPEGYPEGIDKIADEAQAKEFLSEYNSTAEQVWNAYTEASWAYN
TNITDHNKEIMLEKNLAMSKHTLEYGMRARQFDTSDFQDESVTRILKKLSVIERAALPEN
ELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDIMATSRDYDELLFAWKGWRDASG
KKMRNNYKRYVELSNKAAMLNGYKDNGAYWRSLYETSTFEEDLERLYLQLQPLYLNLHAY
VRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKKQGW
TPKKMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQC
TVVNMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAVGDVMALSVSTPKHLHSI
NLLDQVMENKESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDRRIKENEYNKEWWNLRM
KYQGLCPPAPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHKGPLHTC
DIYXXXXXXXXXXDALKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLEKENTKN
GEVLGWPEYSWTPYTVQDDSSKTDFLGMSLTKSQATAGGWVLLALALIFLITTIFLSVKF
FSSRREAFKSISEMELK

BLAST