GenomeNet

>tgu:100218462 K05107 Eph receptor A6 [EC:2.7.10.1] | (RefSeq) EPHA6; EPH receptor A6 (A)
MESDEPHGVKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEVREVGPINKKGFYLAFQ
DIGACIALVSVRVYYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLY
CGADGDWLVPLGRCICSVGYEELEGSCHACRPGFYKAFAGNVKCSKCPPHSLTHIEATSV
CQCEKGYFRAEKDPPTMACTRPPSAPRNVVFNINETALMLEWSPPSDTGGRKDLTYSVVC
KKCGSDASQCEICGGGIRFIPRHTGLTNSSVTVLDFVSHVNYTFEIEATNGVSELSFSPK
QFTAITVTTDQDAPTLIGMVRKDWASQNSIALSWQEPDFPHGAILDYEIKYYEKVYPRIA
PAFWHYLRVEEHEQLSYSSTRSKAPSVIITGLKPATKYIFHIRVRTAAGYSGYSQKFEFE
TGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRAHL
QNGHLHFPGLKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTP
GKREIPVAIKTLKGGYMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPTIGVKSLS
RFLRAGFLNSILASHPVAGGGSLPPSISSGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQ
LVGMLRGIASGMKYLSDMGYVHRDLAARNILVNGNLMCKVSDFGLSRVLEDDPEAAYTTS
GGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYR
LPAPMGCPASLHQLMLHCWQKERNHRPKFSDIVSFLDKLIRNPSTLHTLVEDVLVMPDSP
GEVPEYPLFVSVSDWLDSIKMGQYKNNFMAAGFTTLDMVSRMNIDDIRRIGVALIGHQRR
IVSSLQTLRLHMMHIQEKGFHV

BLAST