GenomeNet

>tgu:100218462 EPHA6; EPH receptor A6; K05107 Eph receptor A6 [EC:2.7.10.1] (A)
MESDEPHGVKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEVREVGPINKKGFYLAFQ
DIGACIALVSVRVYYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLY
CGADGDWLVPLGRCICSVGYEELEGSCHACRPGFYKAFAGNVKCSKCPPHSLTHIEATSV
CQCEKGYFRAEKDPPTMACTRPPSAPRNVVFNINETALMLEWSPPSDTGGRKDLTYSVVC
KKCGSDASQCEICGGGIRFIPRHTGLTNSSVTVLDFVSHVNYTFEIEATNGVSELSFSPK
QFTAITVTTDQDAPTLIGMVRKDWASQNSIALSWQEPDFPHGAILDYEIKYYEKVYPRIA
PAFWHYLRVEEHEQLSYSSTRSKAPSVIITGLKPATKYIFHIRVRTAAGYSGYSQKFEFE
TGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRAHL
QNGHLHFPGLKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTP
GKREIPVAIKTLKGGYMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPTIGVKSLS
RFLRAGFLNSILASHPVAGGGSLPPSISSGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQ
LVGMLRGIASGMKYLSDMGYVHRDLAARNILVNGNLMCKVSDFGLSRVLEDDPEAAYTTS
GGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYR
LPAPMGCPASLHQLMLHCWQKERNHRPKFSDIVSFLDKLIRNPSTLHTLVEDVLVMPDSP
GEVPEYPLFVSVSDWLDSIKMGQYKNNFMAAGFTTLDMVSRMNIDDIRRIGVALIGHQRR
IVSSLQTLRLHMMHIQEKGFHV

BLAST