GenomeNet

>tgu:100219762 G6PC2; glucose-6-phosphatase, catalytic, 2; K01084 glucose-6-phosphatase [EC:3.1.3.9] (A)
MDLLHSNGVLIIQHLQRDYRAYQDFLNFMSYVGDPRNIFSIYFPLWFQLNQVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETMIYPNQSSPCLEQFPITCETGPGSPSGHAMGSS
CVWYVMVTAALGYTVRWKDKSAVTLHRLTWSFLWSIFWIIQISVCISRVFIATHFPHQVV
LGVFAGILVAEAFEHTPAIQTASLRMYIKTNLFLFIFALGFYLSLKLLDIDLLWSVPKAK
KWCANPDWINIDTTPFAGLVRNLGALFGLGLGINSEMFITSCKGKNSCKISFRILCVAAS
LATLQLYNFVKIPTHTEYLFYILSFCKSAAMPLTVVALVPYCVHSLMRTTEKKLN

BLAST