GenomeNet

>tgu:100219762 K01084 glucose-6-phosphatase [EC:3.1.3.9] | (RefSeq) G6PC2; glucose-6-phosphatase catalytic subunit 2 (A)
MDLLHSNGVLIIQHLQRDYRAYQDFLNFMSYVGDPRNIFSIYFPLWFQLNQVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVQETMIYPNQSSPCLEQFPITCETGPGSPSGHAMGSS
CVWYVMVTAALGYTVRWKDKSAVTLHRLTWSFLWSIFWIIQISVCISRVFIATHFPHQVV
LGVFAGILVAEAFEHTPAIQTASLRMYIKTNLFLFIFALGFYLSLKLLDIDLLWSVPKAK
KWCANPDWINIDTTPFAGLVRNLGALFGLGLGINSEMFITSCKGKNSCKISFRILCVAAS
LATLQLYNFVKIPTHTEYLFYILSFCKSAAMPLTVVALVPYCVHSLMRTTEKKLN

BLAST