GenomeNet

>tgu:100222678 G6PC; glucose-6-phosphatase, catalytic subunit; K01084 glucose-6-phosphatase [EC:3.1.3.9] (A)
MEAHMNLLHDVGIRTTHWLQQHFQGSQDWFLFISYAADLRNAFFVLFPIWFHFSETVGIR
LIWVAVIGDWLNLVFKWILFGERPYWWVLDTDYYGNNSAPEIQQFPLTCETGPGSPSGHA
MGAAGWYYVMVTALLSAAGGEKQSRTLRYWVLWTVLWIGFWAVQVCVCMSRVFIAAHFPH
QVIAGVFSGMAVAKTFQHVRCIYQASFHRYLGITIFLFSFTLGFYLLLWTFGVDLLWTLE
KAQKWCSNPEWVHIDTTPFASLLRNLGVLFGLGLALNSHLYQESSRLKQGQQLPFRLGCV
AASLLILHVFDAFKPPSHVQLLFYALSFCKSAAVPLAAVGLIPYCLSQLLATQHKKAA

BLAST