GenomeNet

>tgu:100223004 K05622 transglutaminase 5 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 5-like (A)
MEVIELGEVDLNCPSNCQIHNTHFFGTDRQIIRRGQAFSFYARFQNREWDDTVDQAAFTV
ETGLRPCESNETKCTFPMGRCLDQTCWSASYKVHQPKCISISVFPPSNVCIGRYILNMQI
TSCGHTYQRCLGDFYVLFNPWCADDPVYLDNQAQREEYVLNEHGILYEGVHKHITSRPWH
FGQFEDGILDICLKILDMGASYHHGSDRDHCWRNDPVHVSMVVNHMISSHTTNSIMKIPE
NNDYLKGTKPFSWNGSVPILQQWYSGRCRPVRYGYCGSLASVMCTVMRCLGIPSRVVTSF
CFPCSMENPLGINEIFDSTGKNLCGKDKLWRYHCWNESWMARRDINQCCGDWQCLDPTPL
ETGRGSACSGPTWVRSIREGELDLDYDGHHMFSRVNSNYVGWLSQNNAKRTKFFCDTWPC
GQRLITKSVGSEQFEDITGAYKYELGSVKNKEAYYRAYRRIHPGYCNASNCHIDRELSSL
KNPFLSDSGINMRLKMANCPMYGEDVQLNWLLENLRNENKTLKFNLCAQIITYSGCPMDQ
FWKDSVNVTLGPREVKKIPLCISYNQYGPYLCDHNIMKVVAVSDPECGEILMVSRDIVVN
RPPVIVKLLSQPRLKVPCTAEISFCNPLQEDMKNCVMTLEGCGLFKEPMTIDLGTLASNQ
QARTIVEFTPYRLGCHRLLANLGCHKFAYCKGCAKAEVCCSAGQNGVLPINQNGSFPVCE
NGSVPMNGSGGAGTAVPVADPAFNSMCEYICIPVCNPNCSAGGQPVYDFVYLPAGHPLCN
SICNQGFNPSINPGFEMGCDPGFRVICETVPPATCAPMAPSMYSSMPAPASNPVCTSMPH
VVFETGPAPTHPSGGGGGPMSYSVSVPANNAVSALLTHFMGGPNPNGATQAVPMSAPPSY
SMCSPVIHTIGNPMQPPTPLSVPGASISHVVCSSTPSPTTQPPCGPGATLSSQPLNATVA
HGMCSPVASPAPRAADRSSTPTVLQVGSVSASHSRCSPAPRPVGPPASHSLCSPAPRPVG
PPAAHSLCSPTSASLVAVGSRPASSPAAQPLDSSACLPCSPSPRPLAGPTARSLCAPTSR
SISQLVGTSGSRSLCGSQWGPSYETTTRFGSTWTPASRSLWSPEGRLGYSSTRATYGTLT
RPPYSSYATLPRSTSPSAYATLTRSGSCPSGSTLALAGSRRPWSPTRSTLTYFKRKYL

BLAST