GenomeNet

>tgu:100225647 SETD1B; SET domain containing 1B; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSFRETKAGEKAKHPEDHGKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLADMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTGNEALQLTD
SLKRLKDSSLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSGYKPRRHETKFMDAYNRRPGHHYMHNSAGVFRGTEHQ
FSTFKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSDEQPFPQTSRETEYRR
PAPPPTEMVVESSAAPSIDFVPVKEKPEEPPPLPDSNSVPEPSTASFSQTPERSETPGTP
TMETEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEGSPISSSSSQLSPIPTYGS
NSQPGFRGQTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLSQNSRGTSEASMTPIDQ
LSRTSKTETLEVKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIV
VNSSVSNTAVMAPSIPPLPPPGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPAVTVPPPPL
PAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPMSFQMQTQMLSRMMQAQN
TYQYPPFMTGRMQFVNLPPYRPFSMGAALARGQQWPPLPKFDPSVPPPGYEPKKEDPHKA
TVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGGELEE
KPKPKDRMASCLLENWNKGEGLGYEAIGLGIGLRGAIRLPSFKVKRKEPPEAASAGDQKR
IRPSTSVDDEDEESERDRDASDTTSDLSKKDAEAVGLRRRPARPLELDSEGEEGDETSGK
EEESSSEKEEEQEEDGGLVKAAPGKEEEEDEEDEDDEDEDDDEDEDEDDEEETGIDTSDK
EEEQDSEEDVASPSSSKAEAESSDESEDSSEFESSSDSDDEDEEDDDDEDEEEEEEEEVA
EDQGREAMVAEPEHEPASHELPDDERETILDLYPVDDYMDATGLGLAEPALAVKDEGNEE
IKAGENECGQVLGASVAAETLKHLVMERDHETKLALSPICRPEEESEPTSMLEPEVQECP
KPESQDEEAALCISAPGAVFGEPLPSKSSFFGKSEESSLEGRVKAKPPSAAEEDERLPRT
PGREVMIHLETETLLLPAHKVPSSMLPLPSTPGKEESLVPPEKFPEQLMVTKTSVEEEIP
RTPGRDILAKSSHPLTKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPGI
NSGIPRTPGRDFNFTPTFPEAGATIPCLLPGKKQSEDELEEKTFKEPLGASLTISMNSVP
SPLPFASPPQADFHMDMGLPPDEPIPVAALPCMHGDGRMPIEECKAEVKPVLLSPEVPPG
ASILPPPPPPSVLPKRRPGRPRRSPPSVLSLDVYSGKTIEPPPMPVTLVEGAVGKELLSG
HPDAYYGLKDPEAVTLDFRNDGFHEKIAAETVAEKLPFKELENQWNEDFKEEEAHAKPKR
QWRRQKKTSEELPAIPSPEYSPPQPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMCITYD
RLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKKDKLK
YLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQL
KFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSY
MFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYD
YKFPIEDVKIPCLCGSENCRGTLN

BLAST