GenomeNet

>tgu:100228000 creatine kinase U-type, mitochondrial-like; K00933 creatine kinase [EC:2.7.3.2] (A)
MPNNINWDSRSQDKAHVSDSDFPVANFHPFSSRRPTAFKAFTARKLKSSSDDPSSAFGQA
EHRGSRKGGGRSRAERPDSASVCPAQRRDPSVSYMACNKIFNQTPETSVKRENLSTGNSS
DTVAATESLLQGAAAAPPRAHRGDFTNTGLPGLGETAAPESGAEAQAGPGPGRRAARPLA
ARQRASRAACRAGSTGQHRAAPARTGPERPARASPAAAPESGGAAAPREAGPRTRQAQAK
RGAARDRAAPRRGAAAAAHPALPDSRRQTGPGSGAIGRPTRPRLGGFLLARDSVSAGDRQ
RRRYPPSVEYLDVRALHCMASNLTPAIYARLCDKATPNGWTLDQCIQTGVDNPGHPYIKT
VGIVAGDEETYEVFADLFDPVIQERHNGYNPRTMKHVTDLDATKIKFGQFDERYVLSSRV
RTGRSIRGLSLPPACTRAERREVEKVAVDALSGLTGDLAGRYYRLSEMTENEQQQLIDDH
FLFDKPVSPLLTAAGMARDWPDARGIWHNHQKTFLIWINEEDHTRVISMEKGGNMKRVFE
RFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKI
LENLRLQKRGTGGVDTAAKGGIFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLEKGQ
DIRIPSPLQQFRH

BLAST