GenomeNet

>tgu:100228000 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) creatine kinase U-type, mitochondrial-like (A)
MPNNINWDSRSQDKAHVSDSDFPVANFHPFSSRRPTAFKAFTARKLKSSSDDPSSAFGQA
EHRGSRKGGGRSRAERPDSASVCPAQRRDPSVSYMACNKIFNQTPETSVKRENLSTGNSS
DTVAATESLLQGAAAAPPRAHRGDFTNTGLPGLGETAAPESGAEAQAGPGPGRRAARPLA
ARQRASRAACRAGSTGQHRAAPARTGPERPARASPAAAPESGGAAAPREAGPRTRQAQAK
RGAARDRAAPRRGAAAAAHPALPDSRRQTGPGSGAIGRPTRPRLGGELEEPVGAEQQPHG
WILDDNETYSQDFREAQVQGSLVQEIDGVSSLSVEYLDVRALHCMASNLTPAIYARLCDK
ATPNGWTLDQCIQTGVDNPGHPYIKTVGIVAGDEETYEVFADLFDPVIQERHNGYNPRTM
KHVTDLDATKIKFGQFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVAVDALSGL
TGDLAGRYYRLSEMTENEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNHQKTF
LIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPS
NLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAAKGGIFDISNLDRLGKS
EVELVQLVIDGVNYLIDCERRLEKGQDIRIPSPLQQFRH

BLAST