GenomeNet

>tgu:100229840 MAPK4; mitogen-activated protein kinase 4; K06855 mitogen-activated protein kinase 4/6 [EC:2.7.11.24] (A)
GYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAVSPKLSSSGVPA
VKTGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGGHELEQMQ
LILETIPVIHQEDKEELLKVMPMFINSTWEVRKPLRKLLPEVDSEAIDFLEKILTFNPMD
RLTAEMGLQHPYMSPYSCPEDEPVSQHPFRIEDEIDDILLMEANQSQMSNWDSATSRYHI
SLSSDLDWRHDKHHEMDEVQRDPRAGSESTAEEAQVDPRKYSQSSSERFLELSHSSMDRV
FDADCGKSCDYKVGSPSYLDKLLWRDSKPHHYSEPKLILDLSHWKRATIAPAAELSLEEE
PSNLFLEIAQWVKSTQAGLECPSSLPEMQERSLPSSPHRLHEEPAEVSSETDPDFDLDVF
ISRALKLCAKPEDLPDNKLNEINGACISEHAGDQKERW

BLAST