GenomeNet

>thc:TCCBUS3UF1_10540 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MHRQGWIEVIAGPMFSGKSEELIRRVKRALIARQRVLVFKPRLDNRYGEGHVVSHDGERV
EAIPIARAEEMEAYLKPLPQVVAVDEVQFLDRALLPLVERLAQEGVRVILAGLDLDFRGE
PFGLMPELLARAEFVEKLTAICPRCGAPATRTQRLVDGKPARYTDPIILVGAQEHYEPRC
RACHQVAY

BLAST