GenomeNet

>thi:THI_0135 rbcL; Ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (RuBisCO large subunit) (EC:4.1.1.39); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MAVKTYQAGVKEYRQTYWMPEYTPLDTDLLACFKITPQAGVDREEAAAAVAAESSTGTWT
TVWTDLLTDMDYYKGRAYRIEDVPGDDTCFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAIRALRLEDIRFPIAYVKTCNGPPNGIQVERDVINKYGRPLLGCTIKPKLGLSGKNYGR
AVYECLRGGLDFTKDDENINSQPFMRWKQRFDFVQEATLKAEQETGERKGHYLNVTAPTP
DEMFKRAEYAKEIGAPIIMHDYITGGFCANTGLAQWCRDNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRASTLGWIDLLRESYVPEDRSRGIFFDQD
WGSMPGAFAVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VQARNEGRQVEKEGREILTAAAQHSPELKIAMETWKEIKFEFDTVDKLDVTNK

BLAST