GenomeNet

>thi:THI_0136 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS; Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (RubisCO) (A)
MATVQAYKATKKYETFSYLPQMTPEQVRRQIAYTIAQGWNPAVEHTEKGTSARVSFWYMW
KLPLFGEQSVDAVLAELEACHREFPDHMVRFVAYDNYAQSQGLAFVVYR

BLAST