GenomeNet

>thi:THI_0136 cbbS; Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (RubisCO) (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MATVQAYKATKKYETFSYLPQMTPEQVRRQIAYTIAQGWNPAVEHTEKGTSARVSFWYMW
KLPLFGEQSVDAVLAELEACHREFPDHMVRFVAYDNYAQSQGLAFVVYR

BLAST