GenomeNet

>thm:CL1_0630 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) hypothetical protein (A)
MVSSDFKAMLLKLGVPEERLNVLEGKGGIVEDEFGGIRYVRFRDSARGFRRGTVVFENGD
VVLGFPHIKRIVQLENGIRRVFKGRPFYVEEKVDGYNVRVVKVKDKILALTRGGFVCPFT
TERILDFVNEEFFRDYPNLVLAGEMAGPESPYIVEGPPYVKEDIRFFLFDIQEKGTGRSL
PVEERLKLAEEYGIEHVETFGVYDRSKIDELYELIERLSRERREGIVMKTPDMKRIAKYV
TPYANINDIRIGSHIFFDLPHGYFMGRIKRLAFYLAERKVKGEEFDGYARALGKALLGPF
VESIHEVASGGEVEEVFTVRVKSISTAHKMVTHFERLGVRIHIEDIEDLKNGYWKITFKR
VYPDATREMRELWNGLAFVD

BLAST