GenomeNet

>tid:Thein_0269 DNA ligase D, 3'-phosphoesterase domain-containing protein (A)
MPRFSVQEHHASHLHWDLRLEKDGVLKSWAIPKGPPLEPGVRRLAIQTEDHPLDYIYFEG
IIPPGYYGAGVVKLWDKGEYDIEKWEDEKIVVNFHGEKLKGRYTLLRLRDKNWLIFKNKR
QD

BLAST