GenomeNet

>tid:Thein_0269 no KO assigned | (GenBank) DNA ligase D, 3'-phosphoesterase domain protein (A)
MPRFSVQEHHASHLHWDLRLEKDGVLKSWAIPKGPPLEPGVRRLAIQTEDHPLDYIYFEG
IIPPGYYGAGVVKLWDKGEYDIEKWEDEKIVVNFHGEKLKGRYTLLRLRDKNWLIFKNKR
QD

BLAST