GenomeNet

>tit:Thit_0201 K01207 beta-N-acetylhexosaminidase [EC:3.2.1.52] | (GenBank) glycoside hydrolase family 3 domain protein (A)
MKVNDMTLEEKIGQMLMVGFPLPIYDDHIEELISEYKIGNVILFSRNVKDKVQLQSLCNN
IQMNMIKHTGIPALIAIDQEGGMVTRIYKDATYLPGNMAIAATNNPENAYKIGEIEGKEL
RALGININFAPVLDVNNNPSNPVIGVRSYGENPEKVAEFGINYIKGLQKENVIATAKHFP
GHGDTSVDSHFDLPLVSHNKERLYRIELYPFKKAIENGVEAIMTAHILFLALEKNKLPAT
LSHNILTNILRKELRFNGVIITDCMEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQ
IEVFNEIKEAVLRGEISIERIDESIERIIQLKEKYKLFENPYPDKNKIKTIVGCKEHQEI
AKNISLNSITIVKDENNLLPIKKQKILAVSPETVPVSGVDDTLMDKVSFAKAFVQKFGGV
EKTIPVNPDEDLINTIKEEAKDKEIVVVGAYNASLNEGQVRLVNSLWEVNKNIIVVALRN
PYDLLKFKDVPTYVCAYEYTPLSVESVLEVLSGNYVAKGELPVSL

BLAST