GenomeNet

>tit:Thit_1868 DNA polymerase LigD, ligase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTMIEEKISPMLAFSSDPFDNPEWIYEIKWDGSRTIAFLSNKTRLQDRRLVDITHQFPDL
ALLHKQIKAKEAILDGELVVLKNGKPSYKSIMSRKHQQNLVKINLLSKIMPVIFITWDIL
YLNGKSLVELPLIERKDILRKTVKESEVIKISDFIFEHGKRLFEETGKRGLEGIVAKKVD
SKYLIGKRSKLWLKSKHFIVINAVIIGYRTDKTALILGLYDEENNLINIGSCESGLSQKE
LKAFYEVAKEIKAPDNYYNFKEKNVQWLKPLLTCKVRFMEWSENMKMRAPSFIQFEYNVK
PEECRFE

BLAST