GenomeNet

>tko:TK0465 K01905 acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13] | (GenBank) acetyl-CoA synthetase I (NDP forming), beta subunit (A)
MDRIAKAREIIEKAKAENRPLVEPEAKEILRLYGVPVPDFKVATNEEEAVKFAREIGYPV
VMKIVSPQIIHKSDAGGVKVNIKNDEEARQAFRTIMENARNYKPDADLWGVIIYRMLPLG
KEVIVGMIRDPQFGPAIMFGLGGIFVEILKDVSFRVAPISKDEALEMIKEIKAYPILAGA
RGEKPVDIEALADIIVKVGELALELPEIRELDINPIFAYEDGAVAVDARMLL

BLAST