GenomeNet

>tko:TK0465 acetyl-CoA synthetase I subunit beta; K01905 acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13] (A)
MDRIAKAREIIEKAKAENRPLVEPEAKEILRLYGVPVPDFKVATNEEEAVKFAREIGYPV
VMKIVSPQIIHKSDAGGVKVNIKNDEEARQAFRTIMENARNYKPDADLWGVIIYRMLPLG
KEVIVGMIRDPQFGPAIMFGLGGIFVEILKDVSFRVAPISKDEALEMIKEIKAYPILAGA
RGEKPVDIEALADIIVKVGELALELPEIRELDINPIFAYEDGAVAVDARMLL

BLAST