GenomeNet

>tle:Tlet_1491 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAGKLTLIVGPMYSGKTTELLSYVEIYRLGRKKTIVFKPSLDNRYGVDCVKTHAGVEVEA
IAVEKSADAMKYIKQPVDAVFVDEVQFFDKDLVKIVRQLLDQDVDIFCAGLDMTFKQNPF
ETTMLLMSLANEIIKKKAVCHICGEYNATLTYKFVQDDSEIDIGGKEKYIAVCRDCYNKV
ASKND

BLAST