GenomeNet

>tmb:Thimo_2808 ribulose 1,5-bisphosphate carboxylase, large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MTGDPTLSLSGERLAAVYRLACGPAEVGARARAICVEQTVEFPADLVDDPAIQAQIIGEV
ASIEPIAPGRFEVVIRYPVEAAGRELTQLVNLLFGNVSLQPGVRLQGFTLPGSLLRHYRG
PRFGTPGLRDLVGVQDRPLLCTALKPMGRSPEQLAALAYRLALGGIDLIKDDHGLADQSF
CPFAERVACCTEAVAQANRETGSRSLYLPNITAPTDEIAGRARRAKAAGAGGLLVCPGLI
GFDGVRALADDEALALPILSHPAFQGGYCVNPDAGLGHGVLFGQLNRLTGADAAIFPHWG
GRFAFTQAECRDLVAGATCSMGAIRPILPVPAGGLRLERVTELCDFYGRDCILLIGGDLH
AQGADLVTTCRRFVTLAQANGAAG

BLAST