GenomeNet

>tme:Tmel_0307 Type II site-specific deoxyribonuclease (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MDYKEFINSLSDTNATLSYFTDFKKITDKISKIEIKLHQLNYLIGKRDLRKAVYELFNEN
PSVFDVLNILIAVRDKNKKVVNDEGNIVFLKNYFENPESIYKYLKETGLEEVFIREDIKN
VVDYVFGIEVGLDTNARKNRSGKIMAKIVENIFEKNGIKFSKEIKSDLFPEIMNLGYDLK
CFDYVVQTTEKCYLIETNYYNVGGSKINETTRAYIEIAKKINEYKNYEFVWITDGKSWLS
AKNKIKEAFQHIKHIYNLKTIKRFIEILKEEI

BLAST