GenomeNet

>tml:GSTUM_00000322001 K11987 prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1] | (RefSeq) hypothetical protein (A)
MASNGDGTNGATNGDSKYATQSKPPPPVAKPTRAAVDSTFEQFSNLLHASNRPLPNRFGD
GKDQRPPELKPTGVLTDINTLRRGGFFWESVGTLWDFLKQKAKGGAVDDKTMIMERVIQL
TSRLPPTSKARVALTTLQVDQLWDSLQHPPLSYLGDEFSYRQADGGYNNIMYPQLGRAGS
AYARSVKPMTKMPGAPPDAYTLFDRIFSRGPNDEHFREHDNNVSSMLFYTATIIIHDLFR
TNRENQNISDTSSYLDLAPLYGSSVEDQSKIRTFQDGKIKPDSYSEKRLLAFPPGVSVLL
IMFGRFHNYVVENLKAINEGGRFNLKFPRYPNGDDEVTRQAKALRQQDEDLFQTGRLVTC
GLYINFILNDYLRTIVNLNRVDTTWTLDPRFEASKVYNPDGTPAGIGNMVSAEFNLIYRW
HSCISKRDDQWTKDFYQGLFPGRDASDIEMPEFTRGVGRWERSLSDDPIQRNIAGLERKA
DGSYHDDDLVKILTESVEDVAGAFGARNVPHVLRLVEVLGIEQSRKWMVGSLNELREFFG
LKPHATFEDINPDPAVANTLRQLYDHPDFVEMYAGLVAEADKKPMVPGVGIGPTYTISRA
ILSDAVTLVRGDRFYTADYTASHLTNWGLQEASSDLATVYGCVGYKLILKAFPNHFKFNS
IYAHYPLTIPQENHKIHTALNSVDQFDFERPVYTPPRIPISSYNATKQILCDAENFKVTW
GAGFDFIMRADFMLSGDKPSNSEQKQFVRDRLYLGGVDWKQQIRQFYEEATEKLIRKKAY
SLGDTYQVDAVRDIGNIAQTIFAASIFNLPMKSEDHPKGIYTEQELYMILCVMFIVIFFD
IDSSKSFPLRQAGFKVVRQYGTLVEAQVKAIKNWSWLQGVWDPLNIRGRNKSSPLKSYGW
TMIKRLLDTGKSPYDVTWSYIVPTAGASAPNQGQIFAQVLDFYLEDRNSHHLAEIQRLAQ
SGAVDAWETIKKYALEGGRLAGTFGLYRRVEPDNITIEDNGRNIELRKGDMVFVNFITAS
RDPVVFPDPLEIKLDRPEASYMQYGDGPHECLGKAANIIGLTTMLMQFGKLKGLRRAPGP
QGALKYIPKPGGFKVYMKEDWSAYWPFPTSMKVRFDDII

BLAST