GenomeNet

>tml:GSTUM_00001858001 hypothetical protein; K11484 histone deacetylase HOS3 [EC:3.5.1.98] (A)
MSAPTAVIFHDTSYRHRYSRPNTSLQDLATIVERPERIPAATLGVAAAQTRVGRSRLSIR
KSERMGSLLDLEVMLVHCHAAPVRGAKSSWPEDLAAMCGAAAEKLKKGECEVPKGYHQGD
LYLCEESKEDLEGCLGALYDGVDLVFGGDERNGTISEDDQKRRGVRRAFVCIRPPGKLIS
SQSQAHTNCQSIGHHCAETQPSGFCWLNNVHIAIAHAARAHGLSHAVILDFDLHHGDGSQ
AIAWTLNELAESTHNTSKRTSGIQVPNIGYFSLHDINSYPCEYGDIDKIKNASLNLHAHG
QCMQNVHLAPYSTEGEFWTLYNDKYSSLLTKAREFLSVAAVSKPKKSREFKAGVFLSAGF
DASEHEGAGMQRHAVNVPTSFFARFTSDAVALAEEYCHGRVLSVLEGGYSDRALTTGVFA
HMAGLACAPPEAASTYVSPSLGLTPLHKPLENSGLDRGWDAEWWGMERVLELEGHFAKMT
AKKPNVERASTSYLSPTAASVAKKNDVPRRVMSNGYLDGNNNNGPPPPPPVIPWEVAAFD
LSRMIVPEFRESVEIPPIEKPTKRSARHSVIGVVDPDGTRMTLRDRKPKPAPDPSPDIDR
GRRRMTTTGILPDSAASSRAPSRAVSRAPSRAPSKAPSRPPSRAQRVGAPSRGVTPIPPS
RGTTPAPGGRQIGSTSGGGVTVAGPRKAVVKKPSVIGTDVSKRVVDQHPVTAVQKTSSTI
SSASSVASSSPTGSQEPMKTGCDDDVDSLTKGMFKVKLTYKNRDKDRAEQLRILEQEKER
TERALETEKRRLATNHALKRKEGGVGRMKEAFERNLTGTTAAGSHAEKETKMVDNVEIPV
ACSPMDQTFHGGDIKFADPWQGK

BLAST