GenomeNet

>tml:GSTUM_00003168001 hypothetical protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MWARWSSGCFCDYEYSAVCMVTRFDCLPPPPSSLDKNTPLLPHQALLSSFLSSLRFSFPK
HAVHRISTLPPKEKKSNNLTSIKMVKAVAVVRGDSNVSGTVTFSQENESSPTTISYNITG
NDPNAQRGMHIHEFGDNTNGCTSAGAHFNPFGKSHGAPSDEERHVGDLGNIQTDAQGNAE
GSVEDSLIKLIGPESILGRTIVVHGGTDDLGKGDNVESKKTGNAGPRPACGVIGISA

BLAST