GenomeNet

>tml:GSTUM_00004257001 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MRELIGAPGNDPKTPTPENPTMFQGFEWHTPADQHHWDRLAGAVPKLKEIGITALWIPPA
CKAGNPSSNGYDIYDLYDLGEFDHKWSRPTKWGHKESLIRLRDTAKHHGIGLIFDAVLNH
KANADYTERCRVVEVNPEDRNEVISEPYEIDGWLYFDFATRGDRYSQMKYHWYHFSGTDY
NQENQKTAIYKIIGDNEEKEWCQYVDTSELGNYDYLMFANLDYSNPDVCNDVKNWGVWVT
QELGLKGFRFDAVRHFSLEFLKEFIDHLDKTLGEDWFFVGEYWKGYVEPLEKFLDEMDHR
FSLFDFPLLENIFMISNLPYADLRTIFDGALVERRPLNAVTFVTSHDTQSGQDLERIIPD
YFKPLAYALILLRAEGYPCVFFGDIYGIKGNDPSPPACSGALPSLVLARKLYAYGDQNDF
FDDPNCIGWVRRGTHDRKDGCAVLMSNFGDGEKRIDGDVKIGDDGWAKFRCYAMSVSVWV
NKAAEGRDRFGDL

BLAST