GenomeNet

>tml:GSTUM_00004737001 hypothetical protein; K01077 alkaline phosphatase [EC:3.1.3.1] (A)
MSRRSSTERSAEEDAALLSGRPTNKQAERGKWDGWVKLGLGVWAMAATAGIVVIAVLWVN
NGSGLNSKFPPEGKRNIVFMVSDGMGPTSLALTRSYRQFSDSLPWNHTLTLDKHFIGTSR
TRSSSSLVTDSAAGATAFSCGMKSYNGAISVLPDGSPCGTVLEAAKKAGYMTGLVVTTRI
TDATPACFSAHVNLRGEEDRIAEQQIGDYPLGRMVDLMLGGGRCHFLPNTADGSCRDDSR
DLVSEAQKRFGFSYVDDRKSFDGLKKGAVKLPLLGLFAPTDIPYDIDRKDEDYPSLEEMT
EVALKALEIATKNSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVLAYDRAFKRVSDWIAGS
RYPGVVVSTSDHETGGLAAARQLHEEYPEYLWYPEVLANASSSSEYLAAQYARYEGPADQ
EEDYIRDTILIKGLGIYDASDDEIEAIKDHKDDVASAWVLADVISRRAQVGWTTHGHSGV
DVNIYGSTGTSKLKGNHENTEVGEFLRDYLQVDVDAITKELKGVNRVDAPGLDKAGYEWM
GRPLSELKEAGFETDKLDCYHGQFRHKH

BLAST