GenomeNet

>tml:GSTUM_00004737001 K01077 alkaline phosphatase [EC:3.1.3.1] | (RefSeq) hypothetical protein (A)
MSRRSSTERSAEEDAALLSGRPTNKQAERGKWDGWVKLGLGVWAMAATAGIVVIAVLWVN
NGSGLNSKFPPEGKRNIVFMVSDGMGPTSLALTRSYRQFSDSLPWNHTLTLDKHFIGTSR
TRSSSSLVTDSAAGATAFSCGMKSYNGAISVLPDGSPCGTVLEAAKKAGYMTGLVVTTRI
TDATPACFSAHVNLRGEEDRIAEQQIGDYPLGRMVDLMLGGGRCHFLPNTADGSCRDDSR
DLVSEAQKRFGFSYVDDRKSFDGLKKGAVKLPLLGLFAPTDIPYDIDRKDEDYPSLEEMT
EVALKALEIATKNSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVLAYDRAFKRVSDWIAGS
RYPGVVVSTSDHETGGLAAARQLHEEYPEYLWYPEVLANASSSSEYLAAQYARYEGPADQ
EEDYIRDTILIKGLGIYDASDDEIEAIKDHKDDVASAWVLADVISRRAQVGWTTHGHSGV
DVNIYGSTGTSKLKGNHENTEVGEFLRDYLQVDVDAITKELKGVNRVDAPGLDKAGYEWM
GRPLSELKEAGFETDKLDCYHGQFRHKH

BLAST