GenomeNet

>tml:GSTUM_00005992001 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MSSSKKQTTLGYVKSQTTLGRFFSLPAGTNPATPIQSKLKTISKPGKAADTDDVASPKVR
KTSARGQARKKPTIPEDDGSDGGAGYTKAGVSFSETEMSDASEPAIGSSKQKALGNSSTK
RERPAARKCGIKPSNIKKETETSEDEAPPSKRSKSAPTTKPLKKDCDESELSDEDIAPRK
RLPIINSPKATAKKRKGKVVGKAVDVNTPVSPSGTTKGARSSPISSPVVSPQESGESEPP
LPESPSSTPKISKSKSGSKAKVAKKSPSDKRSKKRGAASDTEAVDKPESSATHKALDSDS
GTEKPSLAPAAGREMIKKLSKSVPPAYPDWVAGEPTPYAALVTTFNLLESTTKRLEKISH
TSRFLRQVLQLSPDELLLVIHLMINKLAADFEGVEMGIGESLLMKAIGESCGRSLERIRE
DQRECGDLGLVAMKSRNNQKTLFAPRPLTIAVVHKGLLGIAKTKGEGGQGRKVSAIRKLL
AAAKGDEAKFLIRGLEGKLRLGLAERTVLVSLSSAMITHEQELVGKTPTTAMLDQSELNL
RSVYSELPSYEIIIPAMREHGIMDIKKYCKLQPGVPVKPMLAKPTKAISEVLDRFENKRF
TCEYKYDGERAQIHYVSPKSSIEYPPATLSGEPIKNLAKVFSRNSEDLSGKYPDILAAMN
EWVRPEVESFVLDCEAVGWDETNNRLLPFQMLQTRKKKDVALEDVKIRVCVHAFDLLFLN
GKPVVRESLDDRRKLMHKTFIEVPNQFVFARYMDSSHLEEIRLFLDQSVKDSCEGLMVKM
MDGPESFYEPSQRSRNWLKIKKDYIDELGDSLDLVVIGAYWGRGKRTSVYGSFLLACYNP
GTQNYESLCNIGTGFTEAELEEFYGTLHPLEIDRAKPFYDHPSGNAGKPDVWFEPKVLWE
VKAADLTLSPRYKAAAGLAGHPDKGVSLRFPRFIGPRTDKTGEDATSSSQIAEMYLRQDQ
VAHKTGAKGVDDDFEY

BLAST