GenomeNet

>tml:GSTUM_00007051001 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MQKASPGVYDEVELVSFQSVSKGMVGECGHRGAYFELVGFDQEVQAQIYKLISIGICPPV
IGQCLVEMMVNPPAPGSPSYQLYQQEYSSIFQSLVLRSRALHEAFVRMEGVECQDPLGAM
YLFPTITIPTAAVEKAQEEGRRPDEYYCMRLLEATGICVTPGSGFGQREGEWHFRTTFLA
PGVDWVARLEKFHEGFMNEFR

BLAST