GenomeNet

>tml:GSTUM_00007613001 hypothetical protein; K02358 elongation factor Tu (A)
MDGAIIVVAASDGQMPQTREHLLLARQVGVQRIVVFVNKVDALEDAEMLELVEMEMRELL
STYGFDGDETPIVMGSALCALEGRRPEIGEQKISELLDAVDTWIPTPQRDLDKPFLMAIE
DVFSIPGRGTVATGRVERGILKRGEEVELVGYEDVPIKTIVTGLETFKKELDSAQAGDNS
GLLLRGIKRDQVRRGMVVVKPGTTKAHNKFLASLYVLTKEEGGRHTGFHGNYRPQMFLRT
SDIPVTIDLPEGSTDDSHKMIMPGDNLEVQCTIFKPMAVDPGQRFNLREGGRTVATGLVT
RIL

BLAST