GenomeNet

>tml:GSTUM_00007613001 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MDGAIIVVAASDGQMPQTREHLLLARQVGVQRIVVFVNKVDALEDAEMLELVEMEMRELL
STYGFDGDETPIVMGSALCALEGRRPEIGEQKISELLDAVDTWIPTPQRDLDKPFLMAIE
DVFSIPGRGTVATGRVERGILKRGEEVELVGYEDVPIKTIVTGLETFKKELDSAQAGDNS
GLLLRGIKRDQVRRGMVVVKPGTTKAHNKFLASLYVLTKEEGGRHTGFHGNYRPQMFLRT
SDIPVTIDLPEGSTDDSHKMIMPGDNLEVQCTIFKPMAVDPGQRFNLREGGRTVATGLVT
RIL

BLAST