GenomeNet

>tml:GSTUM_00007703001 hypothetical protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MSDIDDIDLPDIPRAPVDPSGDTFGPNVILSDSDLDKAYPNRPRNKNPTLPFADLYLSLF
EPLLANKKKRTGVSIRGTNKVLKPHEIRRNIIDRFISRWRNEVGNDIYPTLRLILCEKDR
DRSVYHLKEKTIGRLLVKVMKINKDSDDGYSLINWKQPGTSKSAGDFALRCYEIIRKRPM
RTTPGSLTISQVNSMLDRLSLASKEEEQLPIMTEFYNNMNASELMWLIRIIMRQMKVGAT
ERTFFDAWHPDAAALFNISSSLKRVCWELSDPEFRMDSDGKSVSLMSCFQPQLAQFQKRS
LDDAVKAMHLTPEDPIFWIEEKLDGERMQMHYENGNFMFWSRKAKDYTRLYGSCFDDGSL
TRHLRGAFDDGVKSIILDGEMITWDPRLDCIVAFGTLKTAALEGIRNPFGDGPRPLFKVF
DILHLNGGCLINYSLRDRRMALERSVKTIDRRMEVHKYEEAREAVEIERALRKVIAEASE
GLVIKNPRSIYRLNDRNDDWMKVKPEYMTEFGESLDLVVLGGYWGSGTRGGILSSYLCGL
RVDGNHLKPGEDPMKFRSFCKVGGGFTANDYSKIAHMTDSQWVPWDPKKPPSEHIEIVAG
GRGVDQPDVWIRPDKSIVLEVKAASIVPTDEFRVGKSLRFPRFRQIREDKDWQTALSISE
LIALKEEVEKEKADEEKRIEVENRTRRAGKRMKREYTVLGASDKPADFVSPTVEGGPRLF
EGRSFYVMSDATTPKKMGKAEVEQLIKSHGGNLYQTENAVPDTNVIGDKNNVKISALKKK
GTHDVIRPAWIFDCIRQHELDLQRGQKGCYIIPIEARHILHAASGVERRAAASVDQFGDS
YARDLTMEEISNLLRDMPGAFDRTFASEFVKGLSEHDQRELGELPGWMFKTFVIYVDREG
QGEVNENLKPSPLLALFAGARIALDLQDTEITHIIASHDQQRLHELREAIKWRPRIPRIV
TRDWLKSSLEARTVLDEEQFSPALGCVTGSA

BLAST