GenomeNet

>tml:GSTUM_00007799001 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MASPSKKRKNFSNTQPTRTLHHFFNKQTATKKEALDSVLTPDPQLGPVALTDEQYAKRLA
EEWKQEDKAIRNATPSTHRESSRAGAKRGRSSSPSTKCAASSPHAHSGEEGWKDNLAAAT
LRASRAVTPVQKPNTPRILQEPKRIAASAEGALEIERAIDSMPLGEDPLNPEMARRECHL
CAPYSRIRPGKFNKVKDKDKDTLVNFLRILIRLDPDSLLPAVWLTTNDIGPSYETNEFGI
DGSIISKAIMKASGITPATLKKLNNKHGDPGDVAFEAKVKQRTLMMKKPTPLTIENVYAT
LVKISRASGKGSQEIKQRHIERLLVDAKGEEIRYLTRTLIRHLRIGAVKTTMLIALSRAF
SLSAPKGANWNTPEIPGSKEGRQELFTKAEEFLKQCHARRPNYNDIVPGLLRGGISSLEE
NCGTSIHSPLKPMLGSITRDLGEMLLKLKGCEFTCEYKYDGQRAQIHCDDNGKVSVFSRH
LELMTGKYPDLVQLVPNIRGEGVESFIMEGEVVAMDTETGLVKNFQTLAGRERKNVDVGR
ISVDVCLFAFDLMYLNGQELLSRPFRERRELLQSIRGYHPGLLPFIVRPKIFTPPASGPP
EGAQELESKQIRSRKGKEAAPVKRSSRVKPLLATYEPDKRLESWPKVKKDYTAATDTLDL
VPIAAWYGNGRKAAWWSPILLALHDPETGSFEAVCKCMSGFTDKYYIEMKDTLAPDGINT
SMTKRAYYEVADSLTPAIWFEPREVWEVAFADITVSPTYTAAGQFMEGRGKGLSLRFPRF
VRRREDKGVEEASTPEFLAGLFFKQERDSERISKAAVGGEKKTEGMEQDAEVDGQEFFKN
MRGEGAGSDVNL

BLAST